Urology & Bone Health
Teriparatide
Human parathyroid hormone fragment (1-34) API.
- CAS52232-67-4
- Purity≥98% (HPLC)
- FormLyophilized powder
- Pack sizes10 g, 100 g, 1 kg
Expedited shipping & tier pricing are for buyer-account holders. Request an account or sign in.
- Cold-chain shipping worldwide
- COA & export documents included
- Dedicated B2B account manager
Molecular structure
Structural formula of Teriparatide
- Molecular formula
- C181H291N55O51S2
- Molecular weight
- 4117.77 g/mol
- CAS number
- 52232-67-4
- Sequence / class
- PTH(1-34): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Identity is confirmed by HPLC and mass spectrometry on every batch COA.
Specifications
| CAS number | 52232-67-4 |
|---|---|
| Molecular formula | C181H291N55O51S2 |
| Molecular weight (free base) | 4117.77 g/mol |
| Sequence / structure | PTH(1-34): SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
| Purity | ≥98% (HPLC) |
| Form | Lyophilized powder |
| Storage | -20 °C, protected from light and moisture |
| Pack sizes | 10 g, 100 g, 1 kg |
| Therapeutic area | Urology & Bone Health |
Applications & use
For use by authorised pharmaceutical manufacturers, CROs and licensed compounding pharmacies in accordance with applicable regulations.
Quality assurance
- Batch-specific COA with HPLC purity and MS identity
- Peptide content, water and counter-ion data reported
- GMP / ISO manufacturing documentation for verified buyers
- Cold-chain packaging with stability-appropriate storage
Procurement
Minimum order quantities are product-specific and quoted per RFQ. Typical lead time 2–4 weeks from PO for catalog APIs; custom synthesis quoted per project. See the buyer guide for shipping, payment terms and export documents.
Documents
Batch COA, HPLC / MS report and regulatory documents are provided with your quotation.
Procurement FAQ
Who can order Teriparatide?
Verified business buyers only: pharmaceutical manufacturers, CROs, research institutions and licensed compounding pharmacies.
Which documents come with each batch?
Batch COA (HPLC / MS), MSDS, certificate of origin and commercial invoice as standard; GMP / ISO documents for verified buyers.
What pack sizes and lead times apply?
10 g, 100 g, 1 kg. Typical lead time 2–4 weeks from PO for catalog APIs; custom synthesis quoted per project.
